SCOPe 2.08: Domain d2zpga_: 2zpg A:

Lineage for d2zpga_ (2zpg A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
   automatically mapped to Pfam PF02979

6. Protein automated matches [190256] (6 species)
   not a true protein

7. Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)

8. Domain d2zpga_: 2zpg A: [161599]
   Other proteins in same PDB: d2zpgb_
   automated match to d2ahja_
   complexed with fe, mg, tb0

Details for d2zpga_

PDB Entry: 2zpg, 1.39 Å

PDB Description: Complex of Fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 120min at 293K

PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2zpga_:

Sequence; same for both SEQRES and ATOM records:

>d2zpga_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvp

Timeline for d2zpga_:

• d2zpga_ first appeared in SCOPe 2.01
  
• d2zpga_ appears in SCOPe 2.07