Lineage for d2zpga_ (2zpg A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548277Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2548278Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2548279Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2548299Protein automated matches [190256] (6 species)
    not a true protein
  7. 2548332Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)
  8. 2548336Domain d2zpga_: 2zpg A: [161599]
    Other proteins in same PDB: d2zpgb_
    automated match to d2ahja_
    complexed with fe, mg, tb0

Details for d2zpga_

PDB Entry: 2zpg (more details), 1.39 Å

PDB Description: Complex of Fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 120min at 293K
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2zpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpga_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvp

SCOPe Domain Coordinates for d2zpga_:

Click to download the PDB-style file with coordinates for d2zpga_.
(The format of our PDB-style files is described here.)

Timeline for d2zpga_: