SCOPe 2.06: Domain d2zcfa_: 2zcf A:

Lineage for d2zcfa_ (2zcf A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
   automatically mapped to Pfam PF02979

6. Protein automated matches [190256] (6 species)
   not a true protein

7. Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)

8. Domain d2zcfa_: 2zcf A: [161594]
   Other proteins in same PDB: d2zcfb_
   automated match to d2ahja_
   complexed with fe, mg; mutant

Details for d2zcfa_

PDB Entry: 2zcf, 1.43 Å

PDB Description: mutational study on alpha-gln90 of fe-type nitrile hydratase from rhodococcus sp. n771

PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2zcfa_:

Sequence; same for both SEQRES and ATOM records:

>d2zcfa_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
tenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdp
efrqllltdgtaavaqygylgpngeyivavedtptlknvivcslcsctawpilglpptwy
ksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlq
eivtkdcligvaipqvpt

Timeline for d2zcfa_:

• d2zcfa_ first appeared in SCOPe 2.01
  
• d2zcfa_ appears in SCOPe 2.05
  
• d2zcfa_ appears in SCOPe 2.07
  
• d2zcfa_ appears in the current release, SCOPe 2.08