Lineage for d2zcbb_ (2zcb B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1017617Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1018026Protein automated matches [190118] (3 species)
    not a true protein
  7. 1018031Species Human (Homo sapiens) [TaxId:9606] [189560] (22 PDB entries)
  8. 1018040Domain d2zcbb_: 2zcb B: [161592]
    automated match to d1aara_
    complexed with zn

Details for d2zcbb_

PDB Entry: 2zcb (more details), 1.6 Å

PDB Description: crystal structure of ubiquitin p37a/p38a
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2zcbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcbb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegiaadqqrlifagkqledgrtlsdyn
iqkestlhlvlrl

SCOPe Domain Coordinates for d2zcbb_:

Click to download the PDB-style file with coordinates for d2zcbb_.
(The format of our PDB-style files is described here.)

Timeline for d2zcbb_: