![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d2z31b_: 2z31 B: [161591] Other proteins in same PDB: d2z31c1, d2z31c2, d2z31c3, d2z31d1, d2z31d2 automated match to d1u3hb1 |
PDB Entry: 2z31 (more details), 2.7 Å
SCOPe Domain Sequences for d2z31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z31b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghglrliyysygagstekgdipd gykasrpsqenfsltlesatpsqtsvyfcasgdasggntlyfgagtrlsvl
Timeline for d2z31b_: