Lineage for d2z31a_ (2z31 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744817Domain d2z31a_: 2z31 A: [161590]
    Other proteins in same PDB: d2z31c1, d2z31c2, d2z31c3, d2z31d1, d2z31d2
    automated match to d1ac6a_

Details for d2z31a_

PDB Entry: 2z31 (more details), 2.7 Å

PDB Description: Crystal structure of immune receptor complex
PDB Compounds: (A:) T-cell receptor alpha-chain

SCOPe Domain Sequences for d2z31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z31a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsvtqtggqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsenygnekitfgagtklqvvp

SCOPe Domain Coordinates for d2z31a_:

Click to download the PDB-style file with coordinates for d2z31a_.
(The format of our PDB-style files is described here.)

Timeline for d2z31a_: