Lineage for d1dp7p_ (1dp7 P:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693414Family a.4.5.20: P4 origin-binding domain-like [46856] (2 proteins)
    C-terminus passes through the first loop
  6. 2693415Protein Class II MHC transcription factor RFX1 [46857] (1 species)
  7. 2693416Species Human (Homo sapiens) [TaxId:9606] [46858] (1 PDB entry)
  8. 2693417Domain d1dp7p_: 1dp7 P: [16159]
    protein/DNA complex; complexed with edo, peg

Details for d1dp7p_

PDB Entry: 1dp7 (more details), 1.5 Å

PDB Description: cocrystal structure of rfx-dbd in complex with its cognate x-box binding site
PDB Compounds: (P:) MHC class II transcription factor hrfx1

SCOPe Domain Sequences for d1dp7p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp7p_ a.4.5.20 (P:) Class II MHC transcription factor RFX1 {Human (Homo sapiens) [TaxId: 9606]}
tvqwlldnyetaegvslprstlynhyllhsqeqklepvnaasfgklirsvfmglrtrrlg
trgnskyhyyglrika

SCOPe Domain Coordinates for d1dp7p_:

Click to download the PDB-style file with coordinates for d1dp7p_.
(The format of our PDB-style files is described here.)

Timeline for d1dp7p_: