| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.20: P4 origin-binding domain-like [46856] (2 proteins) C-terminus passes through the first loop |
| Protein Class II MHC transcription factor RFX1 [46857] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46858] (1 PDB entry) |
| Domain d1dp7p_: 1dp7 P: [16159] protein/DNA complex; complexed with edo, peg |
PDB Entry: 1dp7 (more details), 1.5 Å
SCOPe Domain Sequences for d1dp7p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dp7p_ a.4.5.20 (P:) Class II MHC transcription factor RFX1 {Human (Homo sapiens) [TaxId: 9606]}
tvqwlldnyetaegvslprstlynhyllhsqeqklepvnaasfgklirsvfmglrtrrlg
trgnskyhyyglrika
Timeline for d1dp7p_: