| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
Superfamily a.139.1: Type I dockerin domain [63446] (2 families) ![]() |
| Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
| Protein automated matches [190928] (7 species) not a true protein |
| Species Clostridium cellulolyticum [TaxId:1521] [188438] (2 PDB entries) |
| Domain d2vn6b_: 2vn6 B: [161586] Other proteins in same PDB: d2vn6a_ automated match to d1daqa_ complexed with ca |
PDB Entry: 2vn6 (more details), 1.49 Å
SCOPe Domain Sequences for d2vn6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vn6b_ a.139.1.0 (B:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
vivygdynndgnvdstdfaglkkyimaadhayvknldvnldnevnafdlailkkyllgmv
skle
Timeline for d2vn6b_: