| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
Superfamily a.139.1: Type I dockerin domain [63446] (2 families) ![]() |
| Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
| Protein automated matches [190928] (7 species) not a true protein |
| Species Clostridium cellulolyticum [TaxId:1521] [188438] (2 PDB entries) |
| Domain d2vn5d_: 2vn5 D: [161585] Other proteins in same PDB: d2vn5a_, d2vn5c_ automated match to d1daqa_ complexed with ca |
PDB Entry: 2vn5 (more details), 1.9 Å
SCOPe Domain Sequences for d2vn5d_:
Sequence, based on SEQRES records: (download)
>d2vn5d_ a.139.1.0 (D:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
ivygdynndgnvdaldfaglkkyimaadhayvknldvnldnevnstdlailkkyllgm
>d2vn5d_ a.139.1.0 (D:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
ivygdynndgnvdaldfaglkkyimaayvknldvnldnevnstdlailkkyllgm
Timeline for d2vn5d_: