SCOPe 2.05: Domain d2vn5d_: 2vn5 D:

Lineage for d2vn5d_ (2vn5 D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (5 species)
   not a true protein

7. Species Clostridium cellulolyticum [TaxId:1521] [188438] (2 PDB entries)

8. Domain d2vn5d_: 2vn5 D: [161585]
   Other proteins in same PDB: d2vn5a_, d2vn5c_
   automated match to d1daqa_
   complexed with ca

Details for d2vn5d_

PDB Entry: 2vn5, 1.9 Å

PDB Description: the clostridium cellulolyticum dockerin displays a dual binding mode for its cohesin partner

PDB Compounds: (D:) endoglucanase A

SCOPe Domain Sequences for d2vn5d_:

Sequence, based on SEQRES records:

>d2vn5d_ a.139.1.0 (D:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
ivygdynndgnvdaldfaglkkyimaadhayvknldvnldnevnstdlailkkyllgm

Sequence, based on observed residues (ATOM records):

>d2vn5d_ a.139.1.0 (D:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
ivygdynndgnvdaldfaglkkyimaayvknldvnldnevnstdlailkkyllgm

Timeline for d2vn5d_:

• d2vn5d_ first appeared in SCOPe 2.01
  
• d2vn5d_ appears in SCOPe 2.04
  
• d2vn5d_ appears in SCOPe 2.06
  
• d2vn5d_ appears in the current release, SCOPe 2.08