Lineage for d2vn5d_ (2vn5 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734507Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2734508Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2734526Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2734527Protein automated matches [190928] (7 species)
    not a true protein
  7. 2734540Species Clostridium cellulolyticum [TaxId:1521] [188438] (2 PDB entries)
  8. 2734543Domain d2vn5d_: 2vn5 D: [161585]
    Other proteins in same PDB: d2vn5a_, d2vn5c_
    automated match to d1daqa_
    complexed with ca

Details for d2vn5d_

PDB Entry: 2vn5 (more details), 1.9 Å

PDB Description: the clostridium cellulolyticum dockerin displays a dual binding mode for its cohesin partner
PDB Compounds: (D:) endoglucanase A

SCOPe Domain Sequences for d2vn5d_:

Sequence, based on SEQRES records: (download)

>d2vn5d_ a.139.1.0 (D:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
ivygdynndgnvdaldfaglkkyimaadhayvknldvnldnevnstdlailkkyllgm

Sequence, based on observed residues (ATOM records): (download)

>d2vn5d_ a.139.1.0 (D:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
ivygdynndgnvdaldfaglkkyimaayvknldvnldnevnstdlailkkyllgm

SCOPe Domain Coordinates for d2vn5d_:

Click to download the PDB-style file with coordinates for d2vn5d_.
(The format of our PDB-style files is described here.)

Timeline for d2vn5d_: