SCOPe 2.07: Domain d2vn5b_: 2vn5 B:

Lineage for d2vn5b_ (2vn5 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (7 species)
   not a true protein

7. Species Clostridium cellulolyticum [TaxId:1521] [188438] (2 PDB entries)

8. Domain d2vn5b_: 2vn5 B: [161584]
   Other proteins in same PDB: d2vn5a_, d2vn5c_
   automated match to d1daqa_
   complexed with ca

Details for d2vn5b_

PDB Entry: 2vn5, 1.9 Å

PDB Description: the clostridium cellulolyticum dockerin displays a dual binding mode for its cohesin partner

PDB Compounds: (B:) endoglucanase A

SCOPe Domain Sequences for d2vn5b_:

Sequence, based on SEQRES records:

>d2vn5b_ a.139.1.0 (B:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
ivygdynndgnvdaldfaglkkyimaadhayvknldvnldnevnstdlailkkyllgmv

Sequence, based on observed residues (ATOM records):

>d2vn5b_ a.139.1.0 (B:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
ivygdynndgnvdaldfaglkkyimaayvknldvnldnevnstdlailkkyllgmv

Timeline for d2vn5b_:

• d2vn5b_ first appeared in SCOPe 2.01
  
• d2vn5b_ appears in SCOPe 2.06
  
• d2vn5b_ appears in the current release, SCOPe 2.08