Lineage for d2vlpb_ (2vlp B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634940Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1634941Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1634942Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 1634990Protein automated matches [190311] (2 species)
    not a true protein
  7. 1634994Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)
  8. 1634999Domain d2vlpb_: 2vlp B: [161582]
    Other proteins in same PDB: d2vlpa_
    automated match to d1fsjb_
    protein/DNA complex; complexed with mla; mutant

Details for d2vlpb_

PDB Entry: 2vlp (more details), 2 Å

PDB Description: r54a mutant of e9 dnase domain in complex with im9
PDB Compounds: (B:) colicin e9

SCOPe Domain Sequences for d2vlpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlpb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfakavwee
vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhhdkpisqggevydmdnir
vttpkrhidihrgk

SCOPe Domain Coordinates for d2vlpb_:

Click to download the PDB-style file with coordinates for d2vlpb_.
(The format of our PDB-style files is described here.)

Timeline for d2vlpb_: