Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.1: HNH-motif [54061] (3 proteins) |
Protein automated matches [190311] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [187878] (9 PDB entries) |
Domain d2vlpb_: 2vlp B: [161582] Other proteins in same PDB: d2vlpa_ automated match to d1fsjb_ complexed with mla; mutant |
PDB Entry: 2vlp (more details), 2 Å
SCOPe Domain Sequences for d2vlpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vlpb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfakavwee vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhhdkpisqggevydmdnir vttpkrhidihrgk
Timeline for d2vlpb_: