Lineage for d2vlob_ (2vlo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927849Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 2927897Protein automated matches [190311] (2 species)
    not a true protein
  7. 2927901Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)
  8. 2927903Domain d2vlob_: 2vlo B: [161581]
    Other proteins in same PDB: d2vloa2, d2vloa3
    automated match to d1fsjb_
    protein/DNA complex; complexed with so4; mutant

Details for d2vlob_

PDB Entry: 2vlo (more details), 1.8 Å

PDB Description: k97a mutant of e9 dnase domain in complex with im9
PDB Compounds: (B:) colicin e9

SCOPe Domain Sequences for d2vlob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlob_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
skrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevs
kdpelsknlnpsnkssvskgyspftpknqqvggravyelhhdkpisqggevydmdnirvt
tpkrhidihrgk

SCOPe Domain Coordinates for d2vlob_:

Click to download the PDB-style file with coordinates for d2vlob_.
(The format of our PDB-style files is described here.)

Timeline for d2vlob_: