Lineage for d2ve6k_ (2ve6 K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746711Domain d2ve6k_: 2ve6 K: [161576]
    Other proteins in same PDB: d2ve6a1, d2ve6a2, d2ve6d1, d2ve6d2, d2ve6g1, d2ve6g2, d2ve6j1, d2ve6j2
    automated match to d1ddhb_

Details for d2ve6k_

PDB Entry: 2ve6 (more details), 2.65 Å

PDB Description: crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide
PDB Compounds: (K:) Beta-2-microglobulin

SCOPe Domain Sequences for d2ve6k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve6k_ b.1.1.2 (K:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
mqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhasmaepktvywdrdm

SCOPe Domain Coordinates for d2ve6k_:

Click to download the PDB-style file with coordinates for d2ve6k_.
(The format of our PDB-style files is described here.)

Timeline for d2ve6k_: