Lineage for d2vdqa_ (2vdq A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960204Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 960510Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (1 family) (S)
  5. 960511Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein)
  6. 960512Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 960513Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (13 PDB entries)
    Uniprot P08514 32-483
  8. 960520Domain d2vdqa_: 2vdq A: [161571]
    Other proteins in same PDB: d2vdqh1
    automated match to d1tyea_
    complexed with ca, gol, mg, nag

Details for d2vdqa_

PDB Entry: 2vdq (more details), 2.59 Å

PDB Description: integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d2vdqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdqa_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

SCOPe Domain Coordinates for d2vdqa_:

Click to download the PDB-style file with coordinates for d2vdqa_.
(The format of our PDB-style files is described here.)

Timeline for d2vdqa_: