![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) ![]() |
![]() | Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins) |
![]() | Protein Integrin alpha N-terminal domain [69320] (2 species) |
![]() | Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (27 PDB entries) Uniprot P08514 32-483 |
![]() | Domain d2vdqa_: 2vdq A: [161571] Other proteins in same PDB: d2vdqh1 automated match to d1tyea_ complexed with ca, gol, mg, nag |
PDB Entry: 2vdq (more details), 2.59 Å
SCOPe Domain Sequences for d2vdqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdqa_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]} lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs lrgavdiddngypdlivgayganqvavyraqp
Timeline for d2vdqa_: