SCOP 1.69: Domain d1qbjc_: 1qbj C:

Lineage for d1qbjc_ (1qbj C:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.19: Z-DNA binding domain [46853] (4 proteins)
   Pfam 02295

6. Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46855] (2 PDB entries)

8. Domain d1qbjc_: 1qbj C: [16157]

Details for d1qbjc_

PDB Entry: 1qbj, 2.1 Å

PDB Description: crystal structure of the zalpha z-dna complex

SCOP Domain Sequences for d1qbjc_:

Sequence; same for both SEQRES and ATOM records:

>d1qbjc_ a.4.5.19 (C:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens)}
siyqdqeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpp
lwkiav

Timeline for d1qbjc_:

• d1qbjc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qbjc_ appears in SCOP 1.67
  
• d1qbjc_ appears in SCOP 1.71
  
• d1qbjc_ appears in the current release, SCOPe 2.08