Lineage for d2v64e_ (2v64 E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041301Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
    core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213
  4. 1041302Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (1 family) (S)
    N- and C-termini undergo large conformational rearrangement upon ligand binding
  5. 1041303Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)
  6. 1041315Protein automated matches [190416] (1 species)
    not a true protein
  7. 1041316Species Human (Homo sapiens) [TaxId:9606] [187293] (2 PDB entries)
  8. 1041332Domain d2v64e_: 2v64 E: [161563]
    automated match to d1s2ha_

Details for d2v64e_

PDB Entry: 2v64 (more details), 2.9 Å

PDB Description: crystallographic structure of the conformational dimer of the spindle assembly checkpoint protein mad2.
PDB Compounds: (E:) mitotic spindle assembly checkpoint protein mad2a

SCOPe Domain Sequences for d2v64e_:

Sequence, based on SEQRES records: (download)

>d2v64e_ d.135.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnv
veqlkdwlykcsvqklvvvisniesgevlerwqfdiecdkgsgeksqkaiqdeirsvirq
itatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftttihkvn
s

Sequence, based on observed residues (ATOM records): (download)

>d2v64e_ d.135.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnv
veqlkdwlykcsvqklvvvisniesgevlerwqfdiecdksqkaiqdeirsvirqitatv
tflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftttihkvns

SCOPe Domain Coordinates for d2v64e_:

Click to download the PDB-style file with coordinates for d2v64e_.
(The format of our PDB-style files is described here.)

Timeline for d2v64e_: