SCOPe 2.08: Domain d2v64d_: 2v64 D:

Lineage for d2v64d_ (2v64 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
   core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213

4. Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families)
   N- and C-termini undergo large conformational rearrangement upon ligand binding
   automatically mapped to Pfam PF02301

5. Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)

6. Protein automated matches [190416] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187293] (2 PDB entries)

8. Domain d2v64d_: 2v64 D: [161562]
   Other proteins in same PDB: d2v64a3, d2v64c3, d2v64f3
   automated match to d1s2ha_

Details for d2v64d_

PDB Entry: 2v64, 2.9 Å

PDB Description: crystallographic structure of the conformational dimer of the spindle assembly checkpoint protein mad2.

PDB Compounds: (D:) mitotic spindle assembly checkpoint protein mad2a

SCOPe Domain Sequences for d2v64d_:

Sequence, based on SEQRES records:

>d2v64d_ d.135.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnn
vveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdkgsgeksqkaiqdeirsvir
qitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftttihkv
ns

Sequence, based on observed residues (ATOM records):

>d2v64d_ d.135.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnn
vveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdkgsgeksqkaiqdeirsvir
qitatvtflpllevscsfdlliytdkdlpqfitnseevrlrsftttihkvns

Timeline for d2v64d_:

• d2v64d_ first appeared in SCOPe 2.01
  
• d2v64d_ appears in SCOPe 2.07