| Class b: All beta proteins [48724] (174 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
| Protein automated matches [190569] (7 species) not a true protein |
| Species Escherichia coli [TaxId:562] [188033] (4 PDB entries) |
| Domain d2uy6c_: 2uy6 C: [161551] Other proteins in same PDB: d2uy6a1, d2uy6a2, d2uy6b1 automated match to d2uy7b1 |
PDB Entry: 2uy6 (more details), 2.5 Å
SCOPe Domain Sequences for d2uy6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uy6c_ b.2.3.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
apcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafkggngakkgtvkl
aftgpivnghsdeldtnggtglaivvqgagknvvfdgsegdantlkdgenvlhytavvkk
ssavgaavtegafsavanfnltyq
Timeline for d2uy6c_: