SCOPe 2.03: Domain d2uy6c_: 2uy6 C:

Lineage for d2uy6c_ (2uy6 C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein automated matches [190569] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188033] (4 PDB entries)

8. Domain d2uy6c_: 2uy6 C: [161551]
   Other proteins in same PDB: d2uy6a1, d2uy6a2, d2uy6b1
   automated match to d2uy7b1

Details for d2uy6c_

PDB Entry: 2uy6, 2.5 Å

PDB Description: crystal structure of the p pilus rod subunit papa

PDB Compounds: (C:) pap fimbrial major pilin protein

SCOPe Domain Sequences for d2uy6c_:

Sequence; same for both SEQRES and ATOM records:

>d2uy6c_ b.2.3.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
apcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafkggngakkgtvkl
aftgpivnghsdeldtnggtglaivvqgagknvvfdgsegdantlkdgenvlhytavvkk
ssavgaavtegafsavanfnltyq

Timeline for d2uy6c_:

• d2uy6c_ first appeared in SCOPe 2.01
  
• d2uy6c_ appears in SCOPe 2.02
  
• d2uy6c_ appears in SCOPe 2.04
  
• d2uy6c_ appears in the current release, SCOPe 2.08