Lineage for d2uy6c_ (2uy6 C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. Protein automated matches [190569] (9 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [188033] (6 PDB entries)
  8. Domain d2uy6c_: 2uy6 C: [161551]
    Other proteins in same PDB: d2uy6a1, d2uy6a2, d2uy6b1
    automated match to d2uy7b1

Details for d2uy6c_

PDB Entry: 2uy6 (more details), 2.5 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (C:) pap fimbrial major pilin protein

SCOPe Domain Sequences for d2uy6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy6c_ b.2.3.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
apcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafkggngakkgtvkl
aftgpivnghsdeldtnggtglaivvqgagknvvfdgsegdantlkdgenvlhytavvkk
ssavgaavtegafsavanfnltyq

SCOPe Domain Coordinates for d2uy6c_ are not available.

Timeline for d2uy6c_:

Domains from other chains:
(mouse over for more information)
d2uy6a1, d2uy6a2, d2uy6b1