SCOP 1.67: Domain d1qbja_: 1qbj A:

Lineage for d1qbja_ (1qbj A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.19: Z-DNA binding domain [46853] (3 proteins)

6. Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46855] (2 PDB entries)

8. Domain d1qbja_: 1qbj A: [16155]

Details for d1qbja_

PDB Entry: 1qbj, 2.1 Å

PDB Description: crystal structure of the zalpha z-dna complex

SCOP Domain Sequences for d1qbja_:

Sequence; same for both SEQRES and ATOM records:

>d1qbja_ a.4.5.19 (A:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens)}
siyqdqeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpp
lwkia

Timeline for d1qbja_:

• d1qbja_ first appeared (with stable ids) in SCOP 1.55
  
• d1qbja_ appears in SCOP 1.65
  
• d1qbja_ appears in SCOP 1.69
  
• d1qbja_ appears in the current release, SCOPe 2.08