Lineage for d2rfta_ (2rft A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040703Species Influenza b virus (strain b/hong kong/8/73) [TaxId:11531] [188343] (2 PDB entries)
  8. 2040704Domain d2rfta_: 2rft A: [161549]
    Other proteins in same PDB: d2rftb_
    automated match to d2fk0a1
    complexed with nag

Details for d2rfta_

PDB Entry: 2rft (more details), 2.8 Å

PDB Description: Crystal structure of influenza B virus hemagglutinin in complex with LSTa receptor analog
PDB Compounds: (A:) Influenza B hemagglutinin (HA)

SCOPe Domain Sequences for d2rfta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfta_ b.19.1.2 (A:) Hemagglutinin {Influenza b virus (strain b/hong kong/8/73) [TaxId: 11531]}
drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtqtrgklcpnclnc
tdldvalgrpkcmgtipsakasilhevkpvtsgcfpimhdrtkirqlpnllrgyenirls
arnvtnaetapggpyivgtsgscpnvtngngffatmawavpknktatnpltvevpyictk
gedqitvwgfhsddetqmvklygdskpqkftssangvtthyvsqiggfpnqaedeglpqs
grivvdymvqkpgktgtiayqrgvllpqkvwcasgrskvikgslpligeadclhekyggl
nkskpyytgehakaigncpiwvktplklangtkyrppakllk

SCOPe Domain Coordinates for d2rfta_:

Click to download the PDB-style file with coordinates for d2rfta_.
(The format of our PDB-style files is described here.)

Timeline for d2rfta_: