Lineage for d2rdba_ (2rdb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316827Protein Toluene, o-xylene monooxygenase oxygenase subunit TouA [109788] (2 species)
    contains the TouB(TmoB)-binding YHS (sub)domain (Pfam PF04945) in the C-terminal part (401-450)
  7. 2316840Species Pseudomonas stutzeri [TaxId:316] [109789] (6 PDB entries)
    Uniprot O87798
  8. 2316845Domain d2rdba_: 2rdb A: [161548]
    Other proteins in same PDB: d2rdbb_, d2rdbc_
    automated match to d1t0qa_
    complexed with fe, gol, mpo, p6g; mutant

Details for d2rdba_

PDB Entry: 2rdb (more details), 2.1 Å

PDB Description: x-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant
PDB Compounds: (A:) Toluene, o-xylene monooxygenase oxygenase subunit;alpha

SCOPe Domain Sequences for d2rdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdba_ a.25.1.2 (A:) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas stutzeri [TaxId: 316]}
smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
qrekdsgaysikaalerdgfvdradpgwvstmqlhfgawaleeyaastaearmarfakap
gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
trdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq
ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
ahdyewvkayq

SCOPe Domain Coordinates for d2rdba_:

Click to download the PDB-style file with coordinates for d2rdba_.
(The format of our PDB-style files is described here.)

Timeline for d2rdba_: