SCOPe 2.01: Domain d2ra3b_: 2ra3 B:

Lineage for d2ra3b_ (2ra3 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50519] (2 PDB entries)

8. Domain d2ra3b_: 2ra3 B: [161547]
   Other proteins in same PDB: d2ra3c_, d2ra3i_
   automated match to d1trna_
   complexed with ca, so4

Details for d2ra3b_

PDB Entry: 2ra3, 1.46 Å

PDB Description: human cationic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)

PDB Compounds: (B:) Trypsin-1

SCOPe Domain Sequences for d2ra3b_:

Sequence; same for both SEQRES and ATOM records:

>d2ra3b_ b.47.1.2 (B:) Trypsin(ogen) {Human (Homo sapiens) [TaxId: 9606]}
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrktlnndimliklssravinahvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdaggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans

Timeline for d2ra3b_:

• d2ra3b_ is new in SCOPe 2.01-stable
  
• d2ra3b_ appears in SCOPe 2.02
  
• d2ra3b_ appears in the current release, SCOPe 2.08