| Class b: All beta proteins [48724] (180 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein Trypsin(ogen) [50515] (9 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50519] (4 PDB entries) |
| Domain d2ra3a_: 2ra3 A: [161546] Other proteins in same PDB: d2ra3c_, d2ra3i_ automated match to d1trna_ complexed with ca, so4 |
PDB Entry: 2ra3 (more details), 1.46 Å
SCOPe Domain Sequences for d2ra3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ra3a_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens) [TaxId: 9606]}
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrktlnndimliklssravinahvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdaggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans
Timeline for d2ra3a_: