Lineage for d2r9pd_ (2r9p D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794264Protein Trypsin(ogen) [50515] (9 species)
  7. 1794723Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (9 PDB entries)
  8. 1794728Domain d2r9pd_: 2r9p D: [161544]
    Other proteins in same PDB: d2r9pe_, d2r9pf_, d2r9pg_, d2r9pi_
    automated match to d1h4wa_
    complexed with so4

Details for d2r9pd_

PDB Entry: 2r9p (more details), 1.4 Å

PDB Description: human mesotrypsin complexed with bovine pancreatic trypsin inhibitor(bpti)
PDB Compounds: (D:) Trypsin-3

SCOPe Domain Sequences for d2r9pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9pd_ b.47.1.2 (D:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d2r9pd_:

Click to download the PDB-style file with coordinates for d2r9pd_.
(The format of our PDB-style files is described here.)

Timeline for d2r9pd_: