Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (6 PDB entries) |
Domain d2r9pc_: 2r9p C: [161543] Other proteins in same PDB: d2r9pe_, d2r9pf_, d2r9pg_, d2r9pi_ automated match to d1h4wa_ complexed with so4 |
PDB Entry: 2r9p (more details), 1.4 Å
SCOPe Domain Sequences for d2r9pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r9pc_ b.47.1.2 (C:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]} ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
Timeline for d2r9pc_: