Lineage for d2r9pa_ (2r9p A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2406117Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (15 PDB entries)
  8. 2406119Domain d2r9pa_: 2r9p A: [161541]
    Other proteins in same PDB: d2r9pe_, d2r9pf_, d2r9pg_, d2r9pi_
    automated match to d1h4wa_
    complexed with so4

Details for d2r9pa_

PDB Entry: 2r9p (more details), 1.4 Å

PDB Description: human mesotrypsin complexed with bovine pancreatic trypsin inhibitor(bpti)
PDB Compounds: (A:) Trypsin-3

SCOPe Domain Sequences for d2r9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9pa_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d2r9pa_:

Click to download the PDB-style file with coordinates for d2r9pa_.
(The format of our PDB-style files is described here.)

Timeline for d2r9pa_: