SCOPe 2.05: Domain d1d8ka_: 1d8k A:

Lineage for d1d8ka_ (1d8k A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.18: The central core domain of TFIIE beta [46850] (1 protein)
   automatically mapped to Pfam PF02186

6. Protein The central core domain of TFIIE beta [46851] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46852] (2 PDB entries)

8. Domain d1d8ka_: 1d8k A: [16154]

Details for d1d8ka_

PDB Entry: 1d8k

PDB Description: solution structure of the central core domain of tfiie beta

PDB Compounds: (A:) general transcription factor tfiie-beta

SCOPe Domain Sequences for d1d8ka_:

Sequence; same for both SEQRES and ATOM records:

>d1d8ka_ a.4.5.18 (A:) The central core domain of TFIIE beta {Human (Homo sapiens) [TaxId: 9606]}
alsgssgykfgvlakivnymktrhqrgdthpltldeildetqhldiglkqkqwlmtealv
nnpkievidgkyafkpkynvr

Timeline for d1d8ka_:

• d1d8ka_ first appeared (with stable ids) in SCOP 1.55
  
• d1d8ka_ appears in SCOPe 2.04
  
• d1d8ka_ appears in SCOPe 2.06
  
• d1d8ka_ appears in the current release, SCOPe 2.08