Lineage for d1d8ka_ (1d8k A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693362Family a.4.5.18: The central core domain of TFIIE beta [46850] (1 protein)
    automatically mapped to Pfam PF02186
  6. 2693363Protein The central core domain of TFIIE beta [46851] (1 species)
  7. 2693364Species Human (Homo sapiens) [TaxId:9606] [46852] (2 PDB entries)
  8. 2693365Domain d1d8ka_: 1d8k A: [16154]

Details for d1d8ka_

PDB Entry: 1d8k (more details)

PDB Description: solution structure of the central core domain of tfiie beta
PDB Compounds: (A:) general transcription factor tfiie-beta

SCOPe Domain Sequences for d1d8ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ka_ a.4.5.18 (A:) The central core domain of TFIIE beta {Human (Homo sapiens) [TaxId: 9606]}
alsgssgykfgvlakivnymktrhqrgdthpltldeildetqhldiglkqkqwlmtealv
nnpkievidgkyafkpkynvr

SCOPe Domain Coordinates for d1d8ka_:

Click to download the PDB-style file with coordinates for d1d8ka_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ka_: