Lineage for d2qyib_ (2qyi B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792431Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 2792438Protein chymotrypsin inhibitor WCI [50392] (1 species)
  7. 2792439Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries)
  8. 2792445Domain d2qyib_: 2qyi B: [161539]
    Other proteins in same PDB: d2qyia_, d2qyic_
    automated match to d1wbca_
    complexed with ca, ni

Details for d2qyib_

PDB Entry: 2qyi (more details), 2.6 Å

PDB Description: crystal structure of a binary complex between an engineered trypsin inhibitor and bovine trypsin
PDB Compounds: (B:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d2qyib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qyib_ b.42.4.1 (B:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqfrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllka

SCOPe Domain Coordinates for d2qyib_:

Click to download the PDB-style file with coordinates for d2qyib_.
(The format of our PDB-style files is described here.)

Timeline for d2qyib_: