SCOPe 2.08: Domain d2qi9c_: 2qi9 C:

Lineage for d2qi9c_ (2qi9 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein ABC transporter involved in vitamin B12 uptake, BtuD [75209] (1 species)

7. Species Escherichia coli [TaxId:562] [75210] (2 PDB entries)

8. Domain d2qi9c_: 2qi9 C: [161536]
   Other proteins in same PDB: d2qi9a_, d2qi9b_, d2qi9f_
   automated match to d1l7vc_
   complexed with 1pe, peg, po4, so4

Details for d2qi9c_

PDB Entry: 2qi9, 2.6 Å

PDB Description: abc-transporter btucd in complex with its periplasmic binding protein btuf

PDB Compounds: (C:) Vitamin B12 import ATP-binding protein btuD

SCOPe Domain Sequences for d2qi9c_:

Sequence; same for both SEQRES and ATOM records:

>d2qi9c_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}
sivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfagq
pleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddklg
rstnqlsggewqrvrlaavvlqitpqanpagqlllldepmnsldvaqqsaldkilsalsq
qglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygmnfrrldieg
hrmlisti

Timeline for d2qi9c_:

• d2qi9c_ first appeared in SCOPe 2.01
  
• d2qi9c_ appears in SCOPe 2.07