Lineage for d2qi9b_ (2qi9 B:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957408Fold f.22: ABC transporter involved in vitamin B12 uptake, BtuC [81346] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 1957409Superfamily f.22.1: ABC transporter involved in vitamin B12 uptake, BtuC [81345] (1 family) (S)
    automatically mapped to Pfam PF01032
  5. 1957410Family f.22.1.1: ABC transporter involved in vitamin B12 uptake, BtuC [75648] (2 proteins)
  6. 1957411Protein ABC transporter involved in vitamin B12 uptake, BtuC [75649] (1 species)
  7. 1957412Species Escherichia coli [TaxId:562] [75650] (2 PDB entries)
  8. 1957414Domain d2qi9b_: 2qi9 B: [161535]
    Other proteins in same PDB: d2qi9c_, d2qi9d_, d2qi9f_
    automated match to d1l7va_
    complexed with 1pe, peg, po4, so4

Details for d2qi9b_

PDB Entry: 2qi9 (more details), 2.6 Å

PDB Description: abc-transporter btucd in complex with its periplasmic binding protein btuf
PDB Compounds: (B:) Vitamin B12 import system permease protein btuC

SCOPe Domain Sequences for d2qi9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qi9b_ f.22.1.1 (B:) ABC transporter involved in vitamin B12 uptake, BtuC {Escherichia coli [TaxId: 562]}
mltlarqqqrqnirwllslsvlmllalllslsageqwispgdwftprgelfvwqirlprt
lavllvgaalaisgavmqalfenplaepgllgvsngagvgliaavllgqgqlpnwalgls
aiagaliitlillrfarrhlstsrlllagvalgiissalmtwaiyfstsvdlrqlmywmm
ggfggvdwrqswlmlalipvllwissqsrpmnmlalgeisarqlglplwfwrnvlvaatg
wmvgvsvalagaigfiglviphilrlsgltdhrvllpgcalagasallladivarlalaa
aelpigvvtatlgapvfiwlllka

SCOPe Domain Coordinates for d2qi9b_:

Click to download the PDB-style file with coordinates for d2qi9b_.
(The format of our PDB-style files is described here.)

Timeline for d2qi9b_: