Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins) contains all-alpha subdomain inserted after the first strand |
Protein Uncharacterized protein BH0493 [159395] (1 species) |
Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries) Uniprot Q9KFI6 1-423 |
Domain d2qeek1: 2qee K:2-413 [161533] Other proteins in same PDB: d2qeea2, d2qeeb2, d2qeec3, d2qeed2, d2qeee3, d2qeef2, d2qeeg2, d2qeeh2, d2qeei2, d2qeej2, d2qeek2, d2qeel3 automated match to d2pnka1 complexed with cl, mg, zn |
PDB Entry: 2qee (more details), 1.65 Å
SCOPe Domain Sequences for d2qeek1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qeek1 c.1.9.8 (K:2-413) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} sinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdv sieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfak ktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqt khrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriir dcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtml srenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleq liykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvg
Timeline for d2qeek1: