Lineage for d2qeek1 (2qee K:2-413)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833783Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
    contains all-alpha subdomain inserted after the first strand
  6. 2833784Protein Uncharacterized protein BH0493 [159395] (1 species)
  7. 2833785Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
    Uniprot Q9KFI6 1-423
  8. 2833796Domain d2qeek1: 2qee K:2-413 [161533]
    Other proteins in same PDB: d2qeea2, d2qeeb2, d2qeec3, d2qeed2, d2qeee3, d2qeef2, d2qeeg2, d2qeeh2, d2qeei2, d2qeej2, d2qeek2, d2qeel3
    automated match to d2pnka1
    complexed with cl, mg, zn

Details for d2qeek1

PDB Entry: 2qee (more details), 1.65 Å

PDB Description: crystal structure of putative amidohydrolase bh0493 from bacillus halodurans c-125
PDB Compounds: (K:) BH0493 protein

SCOPe Domain Sequences for d2qeek1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qeek1 c.1.9.8 (K:2-413) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
sinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdv
sieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfak
ktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqt
khrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriir
dcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtml
srenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleq
liykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvg

SCOPe Domain Coordinates for d2qeek1:

Click to download the PDB-style file with coordinates for d2qeek1.
(The format of our PDB-style files is described here.)

Timeline for d2qeek1: