Lineage for d2qeef_ (2qee F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1821217Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
    contains all-alpha subdomain inserted after the first strand
  6. 1821218Protein Uncharacterized protein BH0493 [159395] (1 species)
  7. 1821219Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
    Uniprot Q9KFI6 1-423
  8. 1821225Domain d2qeef_: 2qee F: [161528]
    automated match to d2pnka1
    complexed with cl, mg, zn

Details for d2qeef_

PDB Entry: 2qee (more details), 1.65 Å

PDB Description: crystal structure of putative amidohydrolase bh0493 from bacillus halodurans c-125
PDB Compounds: (F:) BH0493 protein

SCOPe Domain Sequences for d2qeef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qeef_ c.1.9.8 (F:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
slsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrn

SCOPe Domain Coordinates for d2qeef_:

Click to download the PDB-style file with coordinates for d2qeef_.
(The format of our PDB-style files is described here.)

Timeline for d2qeef_: