SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2q02c_ (2q02 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2089110Family c.1.15.4: IolI-like [75090] (3 protein domains)
  6. 2089119Protein Putative cytoplasmic protein STM4435 [159419] (1 species)
  7. 2089120Species Salmonella typhimurium [TaxId:90371] [159420] (2 PDB entries)
    Uniprot Q8ZK48 1-271
  8. 2089123Domain d2q02c_: 2q02 C: [161520]
    Other proteins in same PDB: d2q02a2, d2q02b2, d2q02d2
    automated match to d2q02a1
    complexed with cl, unl, zn

Details for d2q02c_

PDB Entry: 2q02 (more details), 2.4 Å

PDB Description: Crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 A resolution
PDB Compounds: (C:) putative cytoplasmic protein

SCOPe Domain Sequences for d2q02c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q02c_ c.1.15.4 (C:) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}
mniektrfcinrkiapglsieaffrlvkrlefnkvelrndmpsgsvtddlnynqvrnlae
kygleivtinavypfnqlteevvkktegllrdaqgvgaralvlcplndgtivppevtvea
ikrlsdlfarydiqglveplgfrvsslrsavwaqqlireagspfkvlldtfhhhlyeeae
kefasridisaiglvhlsgvedtrptealadeqrimlsekdvmqnyqqvqrlenmgyrgi
yafepfssqlaswseaeieeqinrsvslllq

SCOPe Domain Coordinates for d2q02c_:

Click to download the PDB-style file with coordinates for d2q02c_.
(The format of our PDB-style files is described here.)

Timeline for d2q02c_: