![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.17: Cell cycle transcription factor e2f-dp [46847] (2 proteins) heterodimer of two homologous chains |
![]() | Protein Cell cycle transcription factor E2F-4 [88652] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88653] (1 PDB entry) |
![]() | Domain d1cf7a_: 1cf7 A: [16151] Other proteins in same PDB: d1cf7b_ |
PDB Entry: 1cf7 (more details), 2.6 Å
SCOP Domain Sequences for d1cf7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens)} srhekslgllttkfvsllqeakdgvldlklaadtlavrqkrriyditnvlegigliekks knsiqwk
Timeline for d1cf7a_: