SCOPe 2.07: Domain d2pqra_: 2pqr A:

Lineage for d2pqra_ (2pqr A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (10 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Mitochondria fission protein Fis1 [101417] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140836] (3 PDB entries)
   Uniprot P40515 1-138

8. Domain d2pqra_: 2pqr A: [161508]
   automated match to d1y8ma1
   complexed with au

Details for d2pqra_

PDB Entry: 2pqr, 1.88 Å

PDB Description: crystal structure of yeast fis1 complexed with a fragment of yeast caf4

PDB Compounds: (A:) Mitochondria fission 1 protein

SCOPe Domain Sequences for d2pqra_:

Sequence; same for both SEQRES and ATOM records:

>d2pqra_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderlgvki
ltdiykeaesrrreclyyltigcyklgeysmakryvdt

Timeline for d2pqra_:

• d2pqra_ first appeared in SCOPe 2.01
  
• d2pqra_ appears in SCOPe 2.06
  
• d2pqra_ appears in the current release, SCOPe 2.08