SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2p4ad_ (2p4a D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (20 species)
    not a true protein
  7. 2019635Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (28 PDB entries)
  8. 2019649Domain d2p4ad_: 2p4a D: [161504]
    Other proteins in same PDB: d2p4aa_, d2p4ac_
    automated match to d2p42b1
    protein/RNA complex; complexed with so4

Details for d2p4ad_

PDB Entry: 2p4a (more details), 1.9 Å

PDB Description: X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with RNASE A
PDB Compounds: (D:) antibody cab-rn05

SCOPe Domain Sequences for d2p4ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4ad_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgypwtyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggdalvatrygrwgqgtqvtvs
s

SCOPe Domain Coordinates for d2p4ad_:

Click to download the PDB-style file with coordinates for d2p4ad_.
(The format of our PDB-style files is described here.)

Timeline for d2p4ad_: