Lineage for d2p48b_ (2p48 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355069Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2355101Domain d2p48b_: 2p48 B: [161503]
    Other proteins in same PDB: d2p48a_
    automated match to d1bzqk_
    protein/RNA complex; complexed with so4

Details for d2p48b_

PDB Entry: 2p48 (more details), 2.3 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.3A resolution: SE5B-tetra crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
PDB Compounds: (B:) antibody cab-rn05

SCOPe Domain Sequences for d2p48b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p48b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqmvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrmtisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
s

SCOPe Domain Coordinates for d2p48b_:

Click to download the PDB-style file with coordinates for d2p48b_.
(The format of our PDB-style files is described here.)

Timeline for d2p48b_: