Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (15 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (16 PDB entries) |
Domain d2p46d_: 2p46 D: [161501] Other proteins in same PDB: d2p46a_, d2p46c_ automated match to d1bzqk_ protein/RNA complex; complexed with zn |
PDB Entry: 2p46 (more details), 2.5 Å
SCOPe Domain Sequences for d2p46d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p46d_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqmvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly adsvkgrmtisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs s
Timeline for d2p46d_: