Lineage for d1dpua_ (1dpu A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1558Family a.4.5.16: C-terminal domain of RPA32 [46844] (1 protein)
  6. 1559Protein C-terminal domain of RPA32 [46845] (1 species)
  7. 1560Species Human (Homo sapiens) [TaxId:9606] [46846] (1 PDB entry)
  8. 1561Domain d1dpua_: 1dpu A: [16150]

Details for d1dpua_

PDB Entry: 1dpu (more details)

PDB Description: solution structure of the c-terminal domain of human rpa32 complexed with ung2(73-88)

SCOP Domain Sequences for d1dpua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens)}
angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd
dhfkstdae

SCOP Domain Coordinates for d1dpua_:

Click to download the PDB-style file with coordinates for d1dpua_.
(The format of our PDB-style files is described here.)

Timeline for d1dpua_: