![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
![]() | Domain d2p45b_: 2p45 B: [161499] Other proteins in same PDB: d2p45a_ automated match to d1bzqk_ protein/RNA complex; complexed with so4 |
PDB Entry: 2p45 (more details), 1.1 Å
SCOPe Domain Sequences for d2p45b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p45b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqmvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly adsvkgrmtisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs s
Timeline for d2p45b_: