SCOPe 2.01: Domain d2ozzb_: 2ozz B:

Lineage for d2ozzb_ (2ozz B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Hypothetical protein YhfZ [159812] (1 species)

7. Species Shigella flexneri [TaxId:623] [159813] (1 PDB entry)
   Uniprot Q83JA6 1-228

8. Domain d2ozzb_: 2ozz B: [161496]
   automated match to d2ozza1
   complexed with so4

Details for d2ozzb_

PDB Entry: 2ozz, 2.3 Å

PDB Description: crystal structure of yhfz from shigella flexneri

PDB Compounds: (B:) Hypothetical protein yhfZ

SCOPe Domain Sequences for d2ozzb_:

Sequence, based on SEQRES records:

>d2ozzb_ c.94.1.1 (B:) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
innvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirvecllngvydmavvsrl
aaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsadqkimtdvffgd
sdvervdlsyheslqrivkgdvdaviwnvvaeneltmlgleatpltddprflqateavvl
trvddypmqqllravvdkhallahqqrvvsgeqepsy

Sequence, based on observed residues (ATOM records):

>d2ozzb_ c.94.1.1 (B:) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
innvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirvecllngvydmavvsrl
aaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsadqkimtdvffgd
vervdlsyheslqrivkgdvdaviwnvneltmlgleatpltddprflqateavvltrvdd
ypmqqllravvdkhallahqqrvvsgeqepsy

Timeline for d2ozzb_:

• d2ozzb_ is new in SCOPe 2.01-stable
  
• d2ozzb_ appears in SCOPe 2.02
  
• d2ozzb_ appears in the current release, SCOPe 2.08