Lineage for d2ozzb_ (2ozz B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144919Protein Hypothetical protein YhfZ [159812] (1 species)
  7. 2144920Species Shigella flexneri [TaxId:623] [159813] (1 PDB entry)
    Uniprot Q83JA6 1-228
  8. 2144922Domain d2ozzb_: 2ozz B: [161496]
    Other proteins in same PDB: d2ozza2
    automated match to d2ozza1
    complexed with so4

Details for d2ozzb_

PDB Entry: 2ozz (more details), 2.3 Å

PDB Description: crystal structure of yhfz from shigella flexneri
PDB Compounds: (B:) Hypothetical protein yhfZ

SCOPe Domain Sequences for d2ozzb_:

Sequence, based on SEQRES records: (download)

>d2ozzb_ c.94.1.1 (B:) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
innvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirvecllngvydmavvsrl
aaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsadqkimtdvffgd
sdvervdlsyheslqrivkgdvdaviwnvvaeneltmlgleatpltddprflqateavvl
trvddypmqqllravvdkhallahqqrvvsgeqepsy

Sequence, based on observed residues (ATOM records): (download)

>d2ozzb_ c.94.1.1 (B:) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
innvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirvecllngvydmavvsrl
aaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsadqkimtdvffgd
vervdlsyheslqrivkgdvdaviwnvneltmlgleatpltddprflqateavvltrvdd
ypmqqllravvdkhallahqqrvvsgeqepsy

SCOPe Domain Coordinates for d2ozzb_:

Click to download the PDB-style file with coordinates for d2ozzb_.
(The format of our PDB-style files is described here.)

Timeline for d2ozzb_: