| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.6: YdiL-like [109813] (2 proteins) contains extra C-terminal all-alpha dimerization subdomain; the dimer may bind DNA |
| Protein Hypothetical protein SO3848 [158467] (1 species) |
| Species Shewanella oneidensis [TaxId:70863] [158468] (1 PDB entry) Uniprot Q8EAP9 5-166 |
| Domain d2ox6d_: 2ox6 D: [161495] automated match to d2ox6a1 complexed with mg |
PDB Entry: 2ox6 (more details), 1.7 Å
SCOPe Domain Sequences for d2ox6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ox6d_ a.35.1.6 (D:) Hypothetical protein SO3848 {Shewanella oneidensis [TaxId: 70863]}
glnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiiemq
vlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikkeck
lvlevdvslinlnveaykayreqnglsesresrakwaatql
Timeline for d2ox6d_: