SCOPe 2.07: Domain d2ox6b_: 2ox6 B:

Lineage for d2ox6b_ (2ox6 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.6: YdiL-like [109813] (2 proteins)
   contains extra C-terminal all-alpha dimerization subdomain; the dimer may bind DNA

6. Protein Hypothetical protein SO3848 [158467] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [158468] (1 PDB entry)
   Uniprot Q8EAP9 5-166

8. Domain d2ox6b_: 2ox6 B: [161493]
   automated match to d2ox6a1
   complexed with mg

Details for d2ox6b_

PDB Entry: 2ox6, 1.7 Å

PDB Description: Crystal structure of gene product SO3848 from Shewanella oneidensis MR-1

PDB Compounds: (B:) Hypothetical protein SO3848

SCOPe Domain Sequences for d2ox6b_:

Sequence; same for both SEQRES and ATOM records:

>d2ox6b_ a.35.1.6 (B:) Hypothetical protein SO3848 {Shewanella oneidensis [TaxId: 70863]}
iglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiiem
qvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikkec
klvlevdvslinlnveaykayreqnglsesresrakwaatql

Timeline for d2ox6b_:

• d2ox6b_ first appeared in SCOPe 2.01
  
• d2ox6b_ appears in SCOPe 2.06
  
• d2ox6b_ appears in the current release, SCOPe 2.08