Lineage for d2ox6b_ (2ox6 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1733072Family a.35.1.6: YdiL-like [109813] (2 proteins)
    contains extra C-terminal all-alpha dimerization subdomain; the dimer may bind DNA
  6. 1733073Protein Hypothetical protein SO3848 [158467] (1 species)
  7. 1733074Species Shewanella oneidensis [TaxId:70863] [158468] (1 PDB entry)
    Uniprot Q8EAP9 5-166
  8. 1733076Domain d2ox6b_: 2ox6 B: [161493]
    automated match to d2ox6a1
    complexed with mg

Details for d2ox6b_

PDB Entry: 2ox6 (more details), 1.7 Å

PDB Description: Crystal structure of gene product SO3848 from Shewanella oneidensis MR-1
PDB Compounds: (B:) Hypothetical protein SO3848

SCOPe Domain Sequences for d2ox6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox6b_ a.35.1.6 (B:) Hypothetical protein SO3848 {Shewanella oneidensis [TaxId: 70863]}
iglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiiem
qvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikkec
klvlevdvslinlnveaykayreqnglsesresrakwaatql

SCOPe Domain Coordinates for d2ox6b_:

Click to download the PDB-style file with coordinates for d2ox6b_.
(The format of our PDB-style files is described here.)

Timeline for d2ox6b_: